PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004516817.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 178aa    MW: 20083.3 Da    PI: 9.73
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004516817.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.54.7e-201657849
                    HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                      qvtfskRr g++KKA+EL +LC++eva+++fs+ +k y +
  XP_004516817.1 16 TMQVTFSKRRSGLFKKANELAILCGVEVAIVVFSPGNKPYSF 57
                    579********************************9998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554554.84E-25171IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-30160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.74161IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-18323IPR002100Transcription factor, MADS-box
PfamPF003194.0E-241157IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MGRRKIDIVK VKDPNTMQVT FSKRRSGLFK KANELAILCG VEVAIVVFSP GNKPYSFGHP  60
SVDAIAIKFL QDEPIPNDVI GNSSSEFPNI ENLNQQLNDV LAQLQEAQKE SKVLDEVLKE  120
YKATELSQLK ELKNSFIELQ DMVKTRLSDI DISECMILLA QKPVVGINKK VTKRKRRN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-16274174Myocyte-specific enhancer factor 2A
3kov_B2e-16274174Myocyte-specific enhancer factor 2A
3kov_I2e-16274174Myocyte-specific enhancer factor 2A
3kov_J2e-16274174Myocyte-specific enhancer factor 2A
3p57_A2e-16274174Myocyte-specific enhancer factor 2A
3p57_B2e-16274174Myocyte-specific enhancer factor 2A
3p57_C2e-16274174Myocyte-specific enhancer factor 2A
3p57_D2e-16274174Myocyte-specific enhancer factor 2A
3p57_I2e-16274174Myocyte-specific enhancer factor 2A
3p57_J2e-16274174Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004516817.11e-127PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLG7L9886e-82G7L988_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA05G35820.12e-71(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.17e-37AGAMOUS-like 29